PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10033473
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 234aa    MW: 25941.1 Da    PI: 9.1142
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10033473genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.84.5e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+ +++++G g+W++ +r  g+ R++k+c++rw +yl
      Lus10033473 14 KGAWTKEEDQRLISYINLHGQGCWRSLPRAAGLFRCGKSCRLRWINYL 61
                     79********************************************97 PP

2Myb_DNA-binding57.92.3e-1867112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T +Edel+++++ +lG++ W++Ia++++ gRt++++k++w+++l
      Lus10033473  67 RGNFTHQEDELIINLHSLLGNK-WSLIAARLP-GRTDNEIKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.1E-23564IPR009057Homeodomain-like
PROSITE profilePS5129414.949961IPR017930Myb domain
SMARTSM007179.6E-141363IPR001005SANT/Myb domain
SuperFamilySSF466893.88E-2913108IPR009057Homeodomain-like
PfamPF002492.5E-151461IPR001005SANT/Myb domain
CDDcd001673.46E-111661No hitNo description
PROSITE profilePS5129428.43862116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.1E-2865116IPR009057Homeodomain-like
SMARTSM007172.8E-1766114IPR001005SANT/Myb domain
PfamPF002497.8E-1767112IPR001005SANT/Myb domain
CDDcd001674.89E-1369112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 234 aa     Download sequence    Send to blast
MGRSPCCEKE QNNKGAWTKE EDQRLISYIN LHGQGCWRSL PRAAGLFRCG KSCRLRWINY  60
LRPDLKRGNF THQEDELIIN LHSLLGNKWS LIAARLPGRT DNEIKNYWNT HLKRKLYSCG  120
IDPLTHRYLS KTTTTTMTPI RTTQGSSPQE FTMFIGNNNN VGNSDVEVSN SSDSTRATTA  180
EGKLNLELSI GLPSLCCNGS LGSQSSRASN QSLISSKLTL ASADTGFGFY NDA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-291311626128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011007997.19e-86PREDICTED: myb-related protein 308-like
SwissprotP813932e-81MYB08_ANTMA; Myb-related protein 308
SwissprotQ9SZP13e-81MYB4_ARATH; Transcription repressor MYB4
TrEMBLF6HGI13e-86F6HGI1_VITVI; Putative uncharacterized protein
STRINGVIT_07s0130g00040.t019e-86(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF26434221
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16720.18e-84myb domain protein 7